PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P14960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 281aa    MW: 31822.1 Da    PI: 6.6088
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P14960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-181366356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           k++++++ ql++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa+ k
  GSMUA_Achr9P14960_001 13 KKRRLSAAQLRALERSFEVENKLEPERKLRLAQQLGLQPRQVAVWFQNRRARCK 66
                           45689***********************************************99 PP

2HD-ZIP_I/II123.11.3e-3912103192
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrls+ q+++LE+sFe e+kLeperK +la++LglqprqvavWFqnrRAR ktkqlE+dy+aL ++ydal+ + ++L++++e+L 
  GSMUA_Achr9P14960_001  12 EKKRRLSAAQLRALERSFEVENKLEPERKLRLAQQLGLQPRQVAVWFQNRRARCKTKQLERDYAALEANYDALRLDYDSLRRDKESLL 99 
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelk 92 
                            +++ 
  GSMUA_Achr9P14960_001 100 TQIG 103
                            8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.135868IPR001356Homeobox domain
SMARTSM003892.8E-181172IPR001356Homeobox domain
SuperFamilySSF466899.84E-191270IPR009057Homeodomain-like
CDDcd000861.43E-161369No hitNo description
PfamPF000467.7E-161366IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-191575IPR009057Homeodomain-like
PRINTSPR000311.7E-53948IPR000047Helix-turn-helix motif
PROSITE patternPS0002704366IPR017970Homeobox, conserved site
PRINTSPR000311.7E-54864IPR000047Helix-turn-helix motif
PfamPF021831.6E-1668109IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MVEDDEAAVQ GEKKRRLSAA QLRALERSFE VENKLEPERK LRLAQQLGLQ PRQVAVWFQN  60
RRARCKTKQL ERDYAALEAN YDALRLDYDS LRRDKESLLT QIGELKAKLS SGEQRLSFSS  120
VKKEPVVSEA EAKAAPPSSS EKDPAALFYK DGSSESDSSA VLNDENIPRR GKPSSMDAVR  180
PLPTAAETIS APLFLDPDHL SGAIKEEGSL HHQHHHMLMM EEEEPFISFF SDDQPPILNC  240
RVCNVINIYF LKLKLHVFIF ISTLVIHPSL FLSHKTNPST W
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16068RRARCKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009417594.11e-172PREDICTED: homeobox-leucine zipper protein HOX4-like
RefseqXP_009417595.11e-172PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotA2YWC03e-60HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2483e-60HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLM0U0F40.0M0U0F4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P14960_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.21e-44homeobox protein 5